SKU: 21951038540

Human PTH , His tag

Sale price$166.50 Regular price$185.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 12 - Jul 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human PTH , His tagProduct Specification Species Human Synonyms Parathormone, Parathyrin Accession P01270 Amino Acid Sequence Protein sequence(P01270, Ser32 Gln115, with C 10*His) SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQGGGGSHHHHHHHHHH Expression System CHO Molecular Weight Theoretical: 11. 1kDa Actual: 10, 12kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer

Product Specification


Species Human
Synonyms Parathormone, Parathyrin
Accession P01270
Amino Acid Sequence

Protein sequence(P01270, Ser32-Gln115, with C-10*His) SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQGGGGSHHHHHHHHHH

Expression System CHO
Molecular Weight Theoretical:11.1kDa Actual:10, 12kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Parathyroid hormone (PTH), also called parathormone or parathyrin, is a peptide hormone secreted by the parathyroid glands that regulates the serum calcium concentration through its effects on bone, kidney, and intestine. PTH influences bone remodeling, which is an ongoing process in which bone tissue is alternately resorbed and rebuilt over time. PTH is secreted in response to low blood serum calcium (Ca2+) levels. PTH indirectly stimulates osteoclast activity within the bone matrix (osteon), in an effort to release more ionic calcium (Ca2+) into the blood to elevate a low serum calcium level. Disorders that yield too little or too much PTH, such as hypoparathyroidism, hyperparathyroidism, and paraneoplastic syndromes can cause bone disease, hypocalcemia, and hypercalcemia.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 21951038540

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 733 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Mark Central CA
Port Orchard, US
★★★★★ 5
Good for Chewers
Theme: Football, Size: Large
Dogs love it, they been chewing on it and it's like new. Also I put treats inside and they really like that. I have a small pit mix and a puppy shepherd husky mutt. They play tug of war with it and it's holding up really good.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 4, 2026
N
Verified Purchase
NatureGirlM
Lake Worth, US
★★★★★ 5
Great inside toy
Theme: Football, Size: Large
Our Rottie loves these! I wanted something like the Jolly Ball but that is soft for inside the house. She's had a lot of fun with this, picking it up, tossing it, playing soccer, etc.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 15, 2026
D
Verified Purchase
DC
Pawtucket, US
★★★★★ 5
A BIG hit with my BIG dog!
Theme: Football, Size: Large
My Great Dane/Boxer mix LOVES this toy. She is over 100 lbs and very strong. She got a hold of my son's real football last year and after she made the initial holes and deflated it we just let her have it. She completely ripped it to shreds in about 7 months but had such a blast tossing it around and galloping around the yard with it, I knew I had to replace it with something of the same shape but hopefully more durable. This is it! She really adores this. We play catch and tug with it and it seems like it's going to last a really long time. The rubber is flexible but strong. I'll try to get a picture of her with it and load it. I highly recommend this toy. We ordered the Large size, by the way. :-) 2-6-2015 - Update: I am just now ordering a new one. For nearly 4 years, the old one has been kept outside in the rain, sun, snow, and ice. She still loves to grab it, shake it, throw it up in the air and play tug with whenever she's outside. The rubber is just now starting to crack so it's time for a new one.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 2, 2011
A
Verified Purchase
Angel Biezeman
Los Angeles, US
★★★★★ 4
Holding up very well, favorite
Theme: Football, Size: Large, Theme: Football, Size: Large
A few weeks ago I ordered three dog toys for my dogs. I have a German shepherd, Lab mix and a medium mix. The latter boy is the biggest destroyer in our family, he chewed pieces of a black Kong. I did not really have high hopes for this football shaped toy with holes, but it is holding up beyond my expectations. You can see some teeth marks, but they are not chewing it up (yet?). They love to play tug with this, kick it around by themselves, or lie down with it and chew on it. I like it because it is a soft rubber and doesn't make so much noise when they throw it around on my hard flooring. For the price, they are definitely getting a whole lot of fun out of it. Edit: Now, more than a month later, my dog managed to get a small piece off after a heavy chew session. After that first piece apparently it is easy to get more off, and he wants to swallow it so the ball is in the trash.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 29, 2021
D
Verified Purchase
Dawn Workman
Omaha, US
★★★★★ 5
Great product
Theme: Football, Size: Medium
My pup always love JW toys
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 13, 2026

recommand products