SKU: 3002578329

CCoV N protein , His tag

Sale price$40.50 Regular price$45.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 12 - Jul 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CCoV N protein , His tagProduct Specification Synonyms 5' nucleotidase (5' NT), Acid phosphatase 3, Ecto 5' nucleotidase, Protein tyrosine phosphatase ACP3, Thiamine monophosphatase (TMPase), ACP3, ACPP Accession Q7T6S8 Amino Acid Sequence Protein sequence(Q7T6S8, Met1 Asn382, with C 10*His)

Product Specification


Synonyms 5'-nucleotidase (5'-NT), Acid phosphatase 3, Ecto-5'-nucleotidase, Protein tyrosine phosphatase ACP3, Thiamine monophosphatase (TMPase), ACP3, ACPP
Accession Q7T6S8
Amino Acid Sequence

Protein sequence(Q7T6S8, Met1-Asn382, with C-10*His)
MASQGQRVSWGDESTKRRGRSNSRGRKNNDIPLSFFNPVTLKQGSKFWDLCPRDFVPLKIGNKDQQIGYWNRQIRYRMVKGQRKDLPERWFFYYLGTGPHADAKFKQKLDGVVWVAKEGAMTKPTTLGTRGTNNESKALKFDVKVPSEFQLEVNQSRDNSRSRSQSRSQSRTRAQSRGRQQSNNKKDDSVEQAVLAALKKLGVDTEKQQQRARSKSKERSNSKTRDTTPKNENKHTWKRTAGKGDVTKFYGARSSSANFGDSDLVANGNSAKHYPQLAECVPSVSSILFGSHWTAKEDGDQIEVTFTHKYHLPKDDPKTGQFLQQINAYARPSEVAKEQRLRKARSKSAERVEQEVVPDALTENYTDVFDDTQVEIIDEVTNGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Theoretical: 45.1kDa Actual: 50kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 0.1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

The nucleocapsid (N) protein is a protein that packages the positive-sense RNA genome of coronaviruses to form ribonucleoprotein structures enclosed within the viral capsid. The N protein is the most highly expressed of the four major coronavirus structural proteins. In addition to its interactions with RNA, N forms protein-protein interactions with the coronavirus membrane protein (M) during the process of viral assembly. N also has additional functions in manipulating the cell cycle of the host cell.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 3002578329

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 534 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
Karla ayonAmazon
Omaha, US
★★★★★ 5
So good
Great product, very moisturizing and smells really good. Kinda strong but goes away after a few minutes.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 13, 2026
R
Verified Purchase
Rachel R
Natrona Heights, US
★★★★★ 5
Fantastic Product
Most lip balms, chapsticks, lipstick etc will make my skin peel off. I don't get moisture and I end up with chapped lips and open cuts. But since this is so natural it fixed my problem. What's nice is I don't get that gunk buildup on the side of the mouth with white stuff either. This lip balm is very smooth, very hydrating and it smells like dessert. It's gonna be my go-to forever and ever.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 19, 2024
T
Verified Purchase
tkeef
Lexington, US
★★★★★ 3
More cinnamon flavor than vanilla
I really wanted to like this lip balm but, as another person commented, the cinnamon flavor dominates. It does moisturize quite well if you can overlook how spicy the cinnamon tastes. Would have preferred just plain vanilla instead. Not sure I'll keep this.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 25, 2025
M
Verified Purchase
Mandi
Omaha, US
★★★★★ 4
hot cinnamon
Only had this one day and I do like it but would like to note the cinnamon is more like hot tamale cinnamon not cinnamon roll cinnamon. still does the job but my chapped lips give a good burn for maybe 30 sec :( going to check if they have another flavor option for next order
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 28, 2025
M
Verified Purchase
me
Los Angeles, US
★★★★★ 5
Best lip balm I’ve found yet
Every lip balm or chapstick I have ever used has always bothered my lips and made them peel. I’ve tried cheap chapsticks to organic chapsticks to vegan and nothing has ever worked. I figured I’d give this a try since I didn’t have much to lose and I am SO glad I did. This is the first lip balm that hasn’t made my lips peel. I LOVE THIS. And the cinnamon vanilla smells divine. This is definitely going to be my go to from now on.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 19, 2024

recommand products