Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 12 - Jul 17
For Your Every Summer RSVP, with Code: SUMMER15
Description
HRSV Glycoprotein G (Strain A2), His tagProduct Specification Species HRSV Synonyms Major surface glycoprotein G, Attachment glycoprotein G, Membrane bound glycoprotein (mG) Accession P03423 Amino Acid Sequence Protein sequence(P03423, Ser64 Gln298, with C 10*His)
Product Specification
| Species | HRSV |
| Synonyms | Major surface glycoprotein G, Attachment glycoprotein G, Membrane-bound glycoprotein (mG) |
| Accession | P03423 |
| Amino Acid Sequence | Protein sequence(P03423, Ser64-Gln298, with C-10*His) SANHKVTPTTAIIQDATSQIKNTTPTYLTQNPQLGISPSNPSEITSQITTILASTTPGVKSTLQSTTVKTKNTTTTQTQPSKPTTKQRQNKPPSKPNNDFHFEVFNFVPCSICSNNPTCWAICKRIPNKKPGKKTTTKPTKKPTLKTTKKDPKPQTTKSKEVPTTKPTEEPTINTTKTNIITTLLTSNTTGNPELTSQMETFHSTSSEGNPSPSQVSTTSEYPSQPSSPPNTPRQGGGGSHHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | Theoretical:27.2kDa Actual:45-110kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
Respiratory syncytial virus G protein is a protein produced by respiratory syncytial virus. The viral G protein is a highly glycosylated 90 kDa transmembrane protein, primarily responsible for the attachment of RSV to the host cell. Though not required for the production of infectious RSV or virus-like particles, RSV G is necessary for full infectivity and is found on the membrane of mature filaments. Additionally, RSV G interacts with both RSV M and F protein, which appears to be required for complete virion assembly.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.4 ★★★★★
Based on 1311 reviews
Sort
Product Reviews
★★★★★ 4
Fate. She is powerful.
Format: Paperback
“She loves me. And I broke her heart.” (p.246)
Fate. She is powerful. She comes from deep historical roots with points of view that range from philosophy (a diverse range of POVs), Psychology and Religion. Here, fate is frequently portrayed as an inescapable, cosmic force that binds Sienna and Jasmine. An inevitable rather than accidental “destined mates” scenario, believed by one, “she just goes with the flow. Wherever fate takes her,” (p.323) and discredited by the other. And yet free will insists on entering the room. Why? Because choices still happened. Some careful. Some reckless. Fate may have guided the path, but Sienna and eventually Jasmine took control. The turbulence mattered. The risk mattered. “Find Sienna. Be with her. Win at life again.” (p.263) And still, despite everything, the plane landed.
Jasmine, was shaped early by trauma, a mother’s shame cutting deep as she punished her daughter for refusing the narrow role of a dutiful woman and never letting her forget the cost of that refusal. As a result, Jasmine believed she was lacking, selfish, too egotistical, abandoned heritage, family, and God. Nor would she ever find true happiness in the arms of a woman. Stripped of her creative & artistic soul. Once magnanimous, Jasmine went colorless. Alas, the tormented, detached, aloof CEO Ice Queen. Putting duty, image, and reputation first. Sad. Broken. Lost. Caged. Winter presents the struggle well, a trademark and also draws from other Ice Queen characteristics in previous novels.
Sienna the artist, lived for freedom. “A playful fearless spirit, gentle and free, who existed only to roam and learn and embrace new experiences. Someone with an enthusiasm for life and love,” (p.255) reflected sprinkles of Eden (The Villian Series), planted herself within the head and heart of one Jasmine Gemayel. Admired and enamored during her youth, Sienna, as an adult, was fated to melt the Ice.
The story that links these two (past to present) is heartfelt and heartbroken. An accidental opportunity, a meeting of artistic minds, a cage, a bird, a sweet memorable dog, a hurtful twist, an awakening, a second chance, and a happily ever after. A recipe for emotional satisfaction.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 13, 2026
★★★★★ 5
Phenomenal!!!
Format: Kindle
I wholeheartedly loved this book and look forward to listening to it when the audiobook comes out! The characters are well rounded, flawed, and delicious. The dialogue was incredible and the banter was spectacular. This was a hard book to put down and I didn’t want it to end.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 16, 2026
★★★★★ 5
a work of art
Format: Kindle
This book is rich in colors, ideas, characters and story line. It gently makes you fall in love with the characters, and slowly reveals the flaws that make them more human and lovable. The story reminds us how important our words are, and how they can change lives, for better, worse, or both. It also reminds the reader of the importance of not forgetting who you are and your passions. Even in the difficult parts, it was a joy to read.. and the ice queen did not disappoint. This writing was a work of art.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 15, 2026
★★★★★ 5
Lee always knocks it out the park.
Format: Kindle
As always, When She Flies is very well written and the detail is great. I really enjoyed the little nuances in this book. Oliver had to be my favorite with his excitement. It was intriguing to see Ethan grow into more than an antagonist which is what I thought he was going to be. Sienna’s openness and honestly was refreshing and so was Jasmine’s brutal honestly which reminded me of Elena from The Brutal Truth. Overall, I loved this book.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 2, 2026
★★★★★ 5
Winter strikes again
Format: Kindle
No one writes an ice queen quite like Lee Winter. This book has less of her tongue in cheek humor and is a little more angsty. The main characters meet again by chance, or as Sienna would say, fate. Jasmine only vaguely remembers teenage Sienna, and actually thought she was a boy. Sienna, of course, remembers Jasmine because her influence changed the course of Sienna's life.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 6, 2026