SKU: 77673789900

Human IL-8 , His tag

Sale price$166.50 Regular price$185.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 12 - Jul 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-8 , His tagProduct Specification Species Human Synonyms C X C motif chemokine 8, Chemokine (C X C motif) ligand 8, Emoctakin, Granulocyte chemotactic protein 1 (GCP 1), Monocyte derived neutrophil chemotactic factor (MDNCF), CXCL8 Accession P10145 Amino Acid Sequence Protein sequence(P10145, Ser28 Ser99, with C 10*His) SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENSGGGGSHHHHHHHHHH Expression System CHO Molecular Weight Theoretical: 10.

Product Specification


Species Human
Synonyms C-X-C motif chemokine 8, Chemokine (C-X-C motif) ligand 8, Emoctakin, Granulocyte chemotactic protein 1 (GCP-1), Monocyte-derived neutrophil chemotactic factor (MDNCF), CXCL8
Accession P10145
Amino Acid Sequence

Protein sequence(P10145, Ser28-Ser99, with C-10*His) SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENSGGGGSHHHHHHHHHH

Expression System CHO
Molecular Weight

Theoretical:10.1kDa Actual:10kDa

Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Interleukin 8 (IL-8 or chemokine (C-X-C motif) ligand 8, CXCL8) is a chemokine produced by macrophages and other cell types such as epithelial cells, airway smooth muscle cells and endothelial cells. Endothelial cells store IL-8 in their storage vesicles, the Weibel-Palade bodies. IL-8 is initially produced as a precursor peptide of 99 amino acids which then undergoes cleavage to create several active IL-8 isoforms. In culture, a 72 amino acid peptide is the major form secreted by macrophages. Interleukin-8 is a key mediator associated with inflammation where it plays a key role in neutrophil recruitment and neutrophil degranulation. IL-8 has also been implied to have a role in colorectal cancer by acting as an autocrine growth factor for colon carcinoma cell lines or the promotion of division and possible migration by cleaving metalloproteinase molecules. It has also been shown that IL-8 plays an important role in chemoresistance of malignant pleural mesothelioma by inducing expression of transmembrane transporters.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 77673789900

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 948 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
Karla ayonAmazon
Dallas, US
★★★★★ 5
So good
Great product, very moisturizing and smells really good. Kinda strong but goes away after a few minutes.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 13, 2026
R
Verified Purchase
Rachel R
West Palm Beach, US
★★★★★ 5
Fantastic Product
Most lip balms, chapsticks, lipstick etc will make my skin peel off. I don't get moisture and I end up with chapped lips and open cuts. But since this is so natural it fixed my problem. What's nice is I don't get that gunk buildup on the side of the mouth with white stuff either. This lip balm is very smooth, very hydrating and it smells like dessert. It's gonna be my go-to forever and ever.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 19, 2024
T
Verified Purchase
tkeef
Lowell, US
★★★★★ 3
More cinnamon flavor than vanilla
I really wanted to like this lip balm but, as another person commented, the cinnamon flavor dominates. It does moisturize quite well if you can overlook how spicy the cinnamon tastes. Would have preferred just plain vanilla instead. Not sure I'll keep this.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 25, 2025
M
Verified Purchase
Mandi
Grantham, US
★★★★★ 4
hot cinnamon
Only had this one day and I do like it but would like to note the cinnamon is more like hot tamale cinnamon not cinnamon roll cinnamon. still does the job but my chapped lips give a good burn for maybe 30 sec :( going to check if they have another flavor option for next order
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 28, 2025
M
Verified Purchase
me
Lexington, US
★★★★★ 5
Best lip balm I’ve found yet
Every lip balm or chapstick I have ever used has always bothered my lips and made them peel. I’ve tried cheap chapsticks to organic chapsticks to vegan and nothing has ever worked. I figured I’d give this a try since I didn’t have much to lose and I am SO glad I did. This is the first lip balm that hasn’t made my lips peel. I LOVE THIS. And the cinnamon vanilla smells divine. This is definitely going to be my go to from now on.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 19, 2024

recommand products