SKU: 83159648509

Human GZMB , His tag

Sale price$90.00 Regular price$100.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 12 - Jul 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human GZMB , His tagProduct Specification Species Human Synonyms C11, CTLA 1, Cathepsin G like 1 (CTSGL1), Cytotoxic T lymphocyte proteinase 2 (Lymphocyte protease), Fragmentin 2, Granzyme 2, Human lymphocyte protein (HLP), SECT, T cell serine protease 1 3E, CGL1, CSPB, GRB Accession P10144 Amino Acid Sequence Protein sequence(P10144, Gly19 Tyr247, with C 10*His)

Product Specification


Species Human
Synonyms C11, CTLA-1, Cathepsin G-like 1 (CTSGL1), Cytotoxic T-lymphocyte proteinase 2 (Lymphocyte protease), Fragmentin-2, Granzyme-2, Human lymphocyte protein (HLP), SECT, T-cell serine protease 1-3E, CGL1, CSPB, GRB
Accession P10144
Amino Acid Sequence Protein sequence(P10144, Gly19-Tyr247, with C-10*His) GEIIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRYGGGGSHHHHHHHHHH
Expression System HEK293
Molecular Weight Theoretical:27.4kDa Actual:33kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Granzyme B (GZMB) is one of the serine protease granzymes most commonly found in the granules of natural killer cells (NK cells) and cytotoxic T cells. It is secreted by these cells along with the pore forming protein perforin to mediate apoptosis in target cells.Granzyme B has also been found to be produced by a wide range of non-cytotoxic cells ranging from basophils and mast cells to smooth muscle cells. The secondary functions of granzyme B are also numerous. Granzyme B has shown to be involved in inducing inflammation by stimulating cytokine release and is also involved in extracellular matrix remodelling.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 83159648509

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 1498 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
V
Verified Purchase
Veronica
Omaha, US
★★★★★ 5
Light and easy to move around! Still sturdy and tall like I wanted.
Color: Grey, Size: 2 Large Panels
Easily put together, work excellently for a room divider and taller than I am at 5'9" so that makes the privacy really great for our purposes. The feet turn and so you can get them out of a pathway as needed, the middle one that has two posts in it does not move but the end ones do. Very LIGHT so not hard to move around. Fabric is not see through. We have a lamp on one side and you can see the light through it but that is not an issue for us. The price is right!! most cubicle kinds of walls are so, so, so much money. With these being light and still give privacy the price was great. If you want them for sound, this is not the product for you but really most cubicle calls are not going to give you privacy other than visually anyway and these do that well. The size was accurate and so fit exactly how I needed them to and that was an important point for me. I used both of them in L shapes for my room and the size was right on.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 8, 2025
M
Verified Purchase
Marion
Alexandria, US
★★★★★ 5
Almost perfect
Color: Black, Size: 2 Large Panels, Color: Black, Size: 2 Large Panels
The cloth material is sturdy and fits well on the design. Both sides are black and you can't tell a difference between each side. It's extremely light weight and easily movable. We got a double and a single and the single is used as a sliding door. It's definitely not the MOST stable thing but overall it's pretty stable, probably won't work GREAT on carpet. It's not see through at all, which is great, the only downfall is the gap between the two sides. We are using a blanket to cover the gap. It's not 6 foot tall, but you can adjust the feet on it to be taller. Overall it's a great product for the price and can easily be moved out of they way.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 5, 2024
N
Verified Purchase
Neta S.
Carnegie, US
★★★★★ 5
A decent buy
Color: Black, Size: 1 Large Panel
Easy to assemble, good quality fabric, the two horizontal "feet" are supposed to be stabilized by a knob/screw but its always looosening up with even the slightest move, so the only unfortunate thig is that it requires constant turning to tighten it if you adjust its location even a teensy bit. I used it as a backdrop to hold a design of balloons, then since the party I use it as a "semi" partition in a bedroom. Good value for the money since it can be used over and over.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 24, 2025
T
Verified Purchase
Trav Tedesco
Omaha, US
★★★★★ 4
Inexpensive Solution For Privacy
Color: Grey, Size: 2 Large Panels, Color: Grey, Size: 2 Large Panels
This worked for my needs to get privacy on a second-floor patio that faced neighbors about 16 feet away, and was almost exactly the width and height I need, and was looking for. As the patio was about 12 feet in width. The fabric is thin, but not see-through, and works well enough for my specific privacy needs. It wasn't that sturdy, even with the three legs, the top would kind of bend a bit from the weight of the thing, but I knew this from previous comments on reviews, and opted to use C-clamps and some screws to tighten it to the wall so that isn't an issue since I was outside and had walls to be able to screw into. You may have to try something different if using inside. I gave four stars instead of five as the instructions past Step 3 really don't make much sense for Steps 4 and 5 where the two are connected and when legs are put on, but I was able to work through it eventually. They really need to break down the steps for installing the legs with better illustrations. Also, highly recommend having two people work on it or at least having a second person on standby for certain steps just due to the size of them once they are together or for connecting the dividers together in the end.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 10, 2025
C
Verified Purchase
Christine Q.
Dallas, US
★★★★★ 5
Very sturdy & nice looking! Impressive & functional
Color: Black, Size: 2 Large Panels, Color: Black, Size: 2 Large Panels
I needed to divide our living room room in half and create a work room but didn’t want it to be visible so we decided to get this and use it in an L shape. It’s very simple and functional, but it does exactly what I need. I’m contemplating hanging a photograph from a ribbon just to add a little personality to the side that faces the living room room but honestly, it’s much more sturdy than I gave a credit for. I am a full-time reseller so I got foam from the hardware store and covered it in fabric as a background for taking pictures and I have a huge one that’s 6‘ x 3‘ plus another one that’s 4‘ x 4‘ both of which are hanging on the inside of this and it works great. I’m impressed!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 1, 2025

recommand products