SKU: 43358953760

Human Calprotectin(S100A8), His tag

Sale price$90.00 Regular price$100.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 12 - Jul 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Calprotectin(S100A8), His tagProduct Specification Species Human Synonyms Calgranulin A; Calprotectin L1L subunit; Cystic fibrosis antigen (CFAG); Leukocyte L1 complex light chain; Migration inhibitory factor related protein 8 (MRP 8; p8); Urinary stone protein band A; CAGA Accession P05109 Amino Acid Sequence Protein sequence(P05109, Met1 Glu93, with C 10*His) MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKEGGGGSHHHHHHHHHH Expression

Product Specification


Species Human
Synonyms Calgranulin-A; Calprotectin L1L subunit; Cystic fibrosis antigen (CFAG); Leukocyte L1 complex light chain; Migration inhibitory factor-related protein 8 (MRP-8; p8); Urinary stone protein band A; CAGA
Accession P05109
Amino Acid Sequence

Protein sequence(P05109, Met1-Glu93, with C-10*His)
MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKEGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Predicted MW: 12.5 kDa Observed MW: 13.0 kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

S100A8 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine. Altered expression of this protein is associated with the disease cystic fibrosis and post COVID-19 condition.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 43358953760

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 653 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Julia
Phoenix, US
★★★★★ 5
Durable Valet Tray
Color: Black, Color: Black
LOVE this leather valet tray. It’s a very well structured piece that seems like it’ll last. The leather looks flawless and is rather durable. I couldn’t be happier to finally have a place for my husband to drop all of his stuff from his pockets when he gets home from work.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 22, 2026
J
JC
Houston, US
★★★★★ 4
Understated valet tray
Color: Gray, Color: Gray
I like the clean lines and simple shape and the unobtrusive stitching. I'm not crazy about the seam of where the sides of the tray meet, but if the tray is filled, it's not as noticeable. It's a nice catch-all to keep my desk clutter-free!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 20, 2025
A
Verified Purchase
Amazon Customer
Chelsea, US
★★★★★ 5
The quality is amazing
Color: Beige
Looks great on my dresser
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 16, 2025
M
Verified Purchase
Melanie Flowers
Port Orchard, US
★★★★★ 5
Pretty
Color: Gray
The Tray is exactly like the picture ..It pretty and sturdy .The material is great.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 9, 2025
Y
Verified Purchase
Yang
Fort Morgan, US
★★★★★ 5
A Stylish and Functional Addition to My Décor!
Color: Gray 1 Pack, Size: 8" x 8" x 1.8", Color: Gray 1 Pack, Size: 8" x 8" x 1.8"
I recently purchased the ZHEM Valet Tray for Men in Dark Gray, and I couldn't be happier with this product. It's become an indispensable part of my daily routine and home décor. The design and craftsmanship of this tray are outstanding. The dark gray color is elegant and complements my furniture perfectly. It's not just a valet tray; it's also a decorative piece that adds a touch of sophistication to my nightstand and dresser. The size (8x8x1.75 inches) is ideal for holding my daily essentials like my watch, perfume, keys, and even napkins. I appreciate the versatility - it serves as a decorative piece, an organizer, and a functional tray all in one! The quality is top-notch, and it feels sturdy and well-made. It's also easy to clean, which is a big plus. Overall, the Tray has exceeded my expectations. It's a stylish and functional addition to my décor, and I highly recommend it to anyone looking for a versatile and attractive tray for their home. Five stars! ⭐⭐⭐⭐⭐
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 8, 2023

recommand products