Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 12 - Jul 17
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human ATRX , His tagProduct Specification Species Human Synonyms Transcriptional regulator ATRX, ATP dependent helicase ATRX, X linked helicase II, X linked nuclear protein (XNP), Znf HX, RAD54L, XH2 Accession P46100 Amino Acid Sequence Protein sequence(P46100, Gly2250 Asn2450, with C 10*His)
Product Specification
| Species | Human |
| Synonyms | Transcriptional regulator ATRX, ATP-dependent helicase ATRX, X-linked helicase II, X-linked nuclear protein (XNP), Znf-HX, RAD54L, XH2 |
| Accession | P46100 |
| Amino Acid Sequence | Protein sequence(P46100, Gly2250-Asn2450, with C-10*His) MGYHEHDSLLDHKEEEELTEEERKAAWAEYEAEKKGLTMRFNIPTGTNLPPVSFNSQTPYIPFNLGALSAMSNQQLEDLINQGREKVVEATNSVTAVRIQPLEDIISAVWKENMNLSEAQVQALALSRQASQELDVKRREAIYNDVLTKQQMLISCVQRILMNRRLQQQYNQQQQQQMTYQQATLGHLMMPKPPNLIMNPSNGGGGSHHHHHHHHHH |
| Expression System | E.coli |
| Molecular Weight | Theoretical:24.9kDa Actual:27kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
Transcriptional regulator ATRX also known as ATP-dependent helicase ATRX, X-linked helicase II, or X-linked nuclear protein (XNP) is a protein that in humans is encoded by the ATRX gene. It contains an ATPase / helicase domain, and thus it belongs to the SWI/SNF family of chromatin remodeling proteins. ATRX is required for deposition of the histone variant H3.3 at telomeres and other genomic repeats. These interactions are important for maintaining silencing at these sites. Acquired mutations in ATRX have been reported in a number of human cancers including pancreatic neuroendocrine tumours, gliomas, astrocytomas, osteosarcomas, and malignant pheochromocytomas. There is a strong correlation between ATRX mutations and an Alternative Lengthening of Telomeres (ALT) phenotype in cancers.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.1 ★★★★★
Based on 1613 reviews
Sort
Product Reviews
★★★★★ 5
So good
Great product, very moisturizing and smells really good. Kinda strong but goes away after a few minutes.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 13, 2026
★★★★★ 5
Fantastic Product
Most lip balms, chapsticks, lipstick etc will make my skin peel off. I don't get moisture and I end up with chapped lips and open cuts. But since this is so natural it fixed my problem. What's nice is I don't get that gunk buildup on the side of the mouth with white stuff either. This lip balm is very smooth, very hydrating and it smells like dessert. It's gonna be my go-to forever and ever.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 19, 2024
★★★★★ 3
More cinnamon flavor than vanilla
I really wanted to like this lip balm but, as another person commented, the cinnamon flavor dominates. It does moisturize quite well if you can overlook how spicy the cinnamon tastes. Would have preferred just plain vanilla instead. Not sure I'll keep this.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 25, 2025
★★★★★ 4
hot cinnamon
Only had this one day and I do like it but would like to note the cinnamon is more like hot tamale cinnamon not cinnamon roll cinnamon. still does the job but my chapped lips give a good burn for maybe 30 sec :( going to check if they have another flavor option for next order
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 28, 2025
★★★★★ 5
Best lip balm I’ve found yet
Every lip balm or chapstick I have ever used has always bothered my lips and made them peel. I’ve tried cheap chapsticks to organic chapsticks to vegan and nothing has ever worked. I figured I’d give this a try since I didn’t have much to lose and I am SO glad I did. This is the first lip balm that hasn’t made my lips peel. I LOVE THIS. And the cinnamon vanilla smells divine. This is definitely going to be my go to from now on.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 19, 2024